Global Trade leader ecrobot

본문 바로가기
Home > Product > search Acid Etched Glass
Products 20,508 Result
0.33mm Curved 3D Tempered Glass Screen Protector Film For Samsung Gala...
Aug 15 2017
9H Full Cover 3D Curved Tempered Glass screen protector for Samsung Galaxy S8 Mobile Phone Product Description - - - - 1 | Place of Origin | Guang Dong China(Mainland) | 2 | Model …
HS-CODE : 85-
Category : | Electrical machinery and
SHENZHEN GOBELIKE TECHNO...
China [CN]
Scince 2006
Free Member
Samsung Galaxy S8 3D Tempered Glass Screen Protector Transperent Bubbl...
Aug 15 2017
3DfullcurvedcasefriendlytemperedglassscreenprotectorSamsungGalaxy S8 - - - - Item: | S8 Plus 3D Glass, Case Friendly Full Cover Tempered Glass Screen Protector | Model No. | …
HS-CODE : 85-
Category : | Electrical machinery and
SHENZHEN GOBELIKE TECHNO...
China [CN]
Scince 2006
Free Member
9H Hardness IPhone Tempered Glass Screen Protector Full Cover 2.5D Bub...
Aug 15 2017
9H Hardness Bubble Free 0.3 2.5D Tempered Glass Screen Protector for iPhone 7 Features: 1. With 2 or 3 layers 2. Made of chemical processed glass, which has excellent window display, …
HS-CODE : 85-
Category : | Electrical machinery and
SHENZHEN GOBELIKE TECHNO...
China [CN]
Scince 2006
Free Member
Full Cover IPhone Tempered Glass Screen Protector Scratch Resistant Ro...
Aug 15 2017
9H Hardness Full Cover 3D Tempered Glass Screen Protector for iPhone 8 Description: # Made from the Highest Quality Tempered-Glass with 100% Bubble-Free Adhesives for easy installation and n…
HS-CODE : 85-
Category : | Electrical machinery and
SHENZHEN GOBELIKE TECHNO...
China [CN]
Scince 2006
Free Member
ISOXAZOLE-4-CARBOXYLIC ACID ETHYL ESTER
Aug 14 2017
cas 80370-40-7
HS-CODE : -
Category :
Tianjin Chempharmatech.C...
China [CN]
Scince 0
Free Member
Shear Blade for Glass
Aug 12 2017
Glass Shear Blade is mainly used to cut glass scissors to tire molding glass products. Liquid products mainly include single, double, four, five, and two are all steel and steel, reliable product qual…
HS-CODE : -
Category :
Ningjin Rongda Machinery...
China [CN]
Scince 2002
Free Member
Amino acid organic plant fertilizer
Aug 12 2017
Unlike the chemical kind, organic fertilizers feed soil organisms in addition to your plants, helping to build healthy soil—not destroy it.     Nam…
HS-CODE : 3101-00
Category : | Fertilisers | Animal or vegetable fert | Animal/vegetable fertili
Shandong New Power Eco-A...
China [CN]
Scince 2015
Free Member
high nitrogen organic fertilizer including amino acid
Aug 12 2017
Unlike the chemical kind, organic fertilizers feed soil organisms in addition to your plants, helping to build healthy soil—not destroy it.     Nam…
HS-CODE : 3101-00
Category : | Fertilisers | Animal or vegetable fert | Animal/vegetable fertili
Shandong New Power Eco-A...
China [CN]
Scince 2015
Free Member
amino acid organic fertilizer for vegetables
Aug 12 2017
Unlike the chemical kind, organic fertilizers feed soil organisms in addition to your plants, helping to build healthy soil—not destroy it.     Name …
HS-CODE : 3101-00
Category : | Fertilisers | Animal or vegetable fert | Animal/vegetable fertili
Shandong New Power Eco-A...
China [CN]
Scince 2015
Free Member
Indole broad-spectrum plant growth regulator auxin Indole 3 Acetic Aci...
Aug 12 2017
Indole broad-spectrum plant growth regulator auxin Indole 3 Acetic Acid IAA,Cell Division Plant Hormones url:http://www.plantgrowthhormones.com
HS-CODE : -
Category :
Zhengzhou Delong Chemica...
China [CN]
Scince 0
Free Member
Natural Plant Growth Hormones Gibberellins Gibberellic Acid GA4+7 For ...
Aug 12 2017
Natural Plant Growth Hormones Gibberellins Gibberellic Acid GA4+7 For Apple,Website:http://www.plantgrowthhormones.com,Cell Division Plant Hormones
HS-CODE : -
Category :
Zhengzhou Delong Chemica...
China [CN]
Scince 0
Free Member
Coffee Or Tea Glass Mugs Drinking Glasses Double Walled Thermo Insulat...
Aug 12 2017
Coffee Or Tea Glass Mugs Drinking Glasses Double Walled Thermo Insulated Cups,Website:http://www.jasslife.com, Latte Cappuccino Espresso Glassware,Plastic Cup
HS-CODE : -
Category :
Wuyi YiFan Tumbler Co.,L...
China [CN]
Scince 0
Free Member
Stainless Steel Modern Balustrade For Glass Balcony Fencing Railing
Aug 12 2017
Stainless Steel Modern Balustrade For Glass Balcony Fencing Railing,Glass Balustrade url:http://www.winlinstainless.com
HS-CODE : -
Category :
Winlin stainless steel c...
China [CN]
Scince 0
Free Member
Stainless Steel Glass Clamp Glass Holders Glass Clip
Aug 12 2017
Stainless Steel Glass Clamp Glass Holders Glass Clip,Glass Fittings url:http://www.winlinstainless.com
HS-CODE : -
Category :
Winlin stainless steel c...
China [CN]
Scince 0
Free Member
Stainless Steel Handrail Bracket Wall Bracket Glass Bracket
Aug 12 2017
Stainless Steel Handrail Bracket Wall Bracket Glass Bracket,Website:http://www.winlinstainless.com,Handrail Fittings
HS-CODE : -
Category :
Winlin stainless steel c...
China [CN]
Scince 0
Free Member
ECROBOT CO., Ltd, Business Registration Number : 220-88-71747, CEO J.W.Park, TEL : +82-2-552-7676, E-mail : E-mail : Contact us
Address : (Hwanghwa B/D 11F, Yeoksam-dong)320, Gangnam-daero, Gangnam-gu, Seoul, South Korea
About Us Privacy Policy Terms of use Copyright © 2000-2025 ECROBOT.COM. All rights reserved.
Top