Global Trade leader ecrobot

Get in touch with meE-mail: sales5@askplc.comTEL (WhatsApp/Wechat) :  +86-18020714662Name: Veronica Pei  Warranty: 12 monthsLead time: 1-2 working daysType of payment: T/T&nbs…

Get in touch with meE-mail: sales5@askplc.comTEL (WhatsApp/Wechat) :  +86-18020714662Name: Veronica Pei  Warranty: 12 monthsLead time: 1-2 working daysType of payment: T/T&nbs…

Get in touch with meE-mail: sales5@askplc.comTEL (WhatsApp/Wechat) :  +86-18020714662Name: Veronica Pei  Warranty: 12 monthsLead time: 1-2 working daysType of payment: T/T&nbs…

Get in touch with meE-mail: sales5@askplc.comTEL (WhatsApp/Wechat) :  +86-18020714662Name: Veronica Pei  Warranty: 12 monthsLead time: 1-2 working daysType of payment: T/T&nbs…

Sales manager: Veronica PeiEmail: sales5@askplc.comSkype/Whatsapp/Wechat: +86 18020714662  100% full New! - Original Factory Seal !Warranty: 12 months!Package: Original packing with cartons.Delivery time: Shipped in 3 days after paymentship…

Sales manager: Veronica PeiEmail:  sales5@askplc.comTEL (WhatsApp/Wechat) :  +86-18020714662ABOUT  US :Moore Automation Limited  is a high-tech enterprise specialized in professional sales of industrial automation components, and is committed to improving the …

Description：MOORE 16137-116  16137-115Model Number: 16137-116  16137-115Condition：Original Brand NewWarranty:12 MonthsMOQ：1 PiecePackage:100% Original PackagePayment term:T/TShipping Ways:DHLDelivery time:1-3 DaysInquiry response time:Within 1 HourService:After-sales Se…

CATERPILLAR,GOODRICH,CARLISLE,EUCLID,TEREX etc. BRAKE PAD 244-7836,328-7836,12975248,E12977724,12975249,E12977721,E12977723,244-733-1,15265336,15266826,BRK10006,244-733-2,15265337,15501590,MA733-1,MA733-2,DB106,DB107,00112768 2V9135,7K5057,7K5059,8R0821,8R0807,3V5465,7K4941,1V2778,4V7062,9C0…

The model of 114x900EQ astronomical binoculars has a superior performance. 114x900EQ astronomical binoculars has a small size and easy to carry, use for the amateur astronomer and students. 114x900EQ astronomical binoculars Specifications:     Model&…

Dongguan Pulin Metal Co., Ltd. was established in year 2005. We have been exporting a wide range of metal inclusive of stainless steel, aluminium, alloy, copper and many more products to worldwide market like North and South America, Europe, Middle East and Asia countries. The industries we suppor…

· Height: 1000mm, 1100mm, 1200mm etc.· Outer Diameter: 90mm, 114mm, 140mm, 165mm etc.· Wall Thickness: 4mm, 5mm etc.· Base Plate Size: 225x225x12mm, 250x250x12mm etc.· Top: Steel cap.· Surface: Galvanized and powder coated yellow.· Benefits: Protects utilities…

CAS NO.114466-38-5 GRF 1-29 peptide Sermorelin Acetate 2mg 5mg for bodybuilding - - - - Product Name: | Sermorelin | Synonyms: | SERMORELIN;SERMORELIN ACETATE;YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2;TYR-ALA-ASP-ALA-ILE-PHE-THR-ASN-SER-TYR-ARG-LYS-VAL-LEU-GLY-GLN-LEU-SER-ALA-ARG-LYS-LEU-LE…

Outer Diameter 273mm Stainless Steel Deep Well Pipe Base Screen Pipe Base Screen Information: 1. Hengyuanscreen pipe contain single-deck well screen,double-deck well screen,pipe base well screen etc. 2. End connection:welded rings,threaded couplings 3. The length upto 6000mm 4. Used …

Air Conditioner Aluminium Fin Foil 1100 1200 1145 8011 8006 for Refrigerator and Radiator Aluminium fin foil : hydrophilic aluminium foil finstock is widely used in household air conditioner ,refrigerrator ,cold equipment and vehicle air ec 1. alloy :1100,1200,1145,8011,8006 2. temper :h12,…

Hot Sale 43kg Heavy Steel Rail From China OUR SERVICES: 1) Quality & Service: Welcome to visit Our factory is the best way to know each other more.Any The Third Inspection likely SGS,BV,CQC or others can prove our products 2) Price: In order to serve more better to our customer…

Genuine BMW Car Oil Filter 11428513377 11 42 8 513 377 11 42 7 788 460 11 42 7 788 461 Product Specification - - - - Item name | Oil Filter | OEM | 11428513377 11 42 8 513 377 | Application | BMW Oil Filter | Materials | High quality filter paper/ metal | Color | Same as picture / optional…

Genuine BMW Car Oil Filter 11428575211 11 42 8 575 211 MANN HU6014Z MAHLE OX8131D Product Specification - - - - Item name | Oil Filter | OEM | 11428575211 11 42 8 575 211 | Application | BMW Oil Filter | Materials | High quality filter paper/ metal | Color | Same…

90663-1143 14 Positions Header Connector 0.100 (2.54mm) Through Hole Gold,Connector url:http://www.asco-ic.com

Three Phase 1140v high Frequency Inverter, VFD Ac Drive,EV510 High Performance Inverter url:http://www.olupower.com

Genuine BMW Car Oil Filter 11428513377 11 42 8 513 377 11 42 7 788 460 11 42 7 788 461 Product Specification - - - - Item name | Oil Filter | OEM | 11428513377 11 42 8 513 377 | Application | BMW Oil Filter | Materials | High quality filter paper/ metal | Color | Same as picture / optional…

We are the OEM of diesel fuel injection pump and part since 1982. Our products include nozzle, elements & plunger, delivery valve, VE-pump head & rotor, cam disk, control shaft, feed pump, magnet valve, regulating valve and so on parts. Our products can be used as replacement of BOSCH, ZEXEL, …

Our competitive price and the same quality will meet your need fairly. We are the OEM of diesel fuel injection pump and part since 1982. Our products include nozzle, elements & plunger, delivery valve, VE-pump head & rotor, cam disk, control shaft, feed pump, magnet valve, regulating valve and …

LUCAS DPA-Head rotor : Engine Model Pumps D 3900T Perkins 4236 DPAM 3842 F495 ARO CAMPULUNG ROMANIA Engine Model Pumps UTB D127 DPAM 3842 F010 UTB D127 DPAM 3842 F018 UTB D127 DPAM 3842 F052 DX 28 DPAM 3842 F052 UTB D127 DPAM 3842 F010 UTB D127 DPAM 3842 F018 DX 28 DPAM 3842 F052 DX 28…