Quick Detail
Place of Origin
Brand Name
For Sumsung
Model Number
For S8
HS-CODE
85-
Package & Delivery Lead Time
Package
Wholesale package or retail package
Delivery Lead Time
12 days after payment
Detailed Description
3DfullcurvedcasefriendlytemperedglassscreenprotectorSamsungGalaxy S8
- - - -
Item: | S8 Plus 3D Glass, Case Friendly Full Cover Tempered Glass Screen Protector |
Model No. | B003 |
Fits for: | for Samsung Galaxy S8 |
Packaging: | Retail Box Packaging |
Color: | Black, transparent |
Main Features: | 1) Made from the Highest Quality Tempered Glass with 100% Bubble-Free Adhesives for Easy Installation and No Residue When Removed.
2) 0.33mm 9H Hardness Anti-Scratch, Anti-Fingerprint, Bubble Free.
3) 99.99% HD Clarity and Maintains the Original Touch Experience.
4) Hydrophobic and Oleo-phobic Coatings Protect against Sweat and Oil Residue from Fingerprint.
5) Protected by Wihitop No-Hassle Lifetime Replacement Warranty. |
Quality Control: | All of Our Products Must Pass the Inspection by Our Professional QC Team. |
Main Products: | Regular Tempered Glass, 3D Full Cover Tempered Glass for Almost Smartphones |
- - - -
Packing:We care each single parcel with utmost quality package. Our standard of packing requires our packing teammates to pack every item with poly bag, foam protective film, usually 10 pieces per batch, then put neatly to master export box. Outside of carton, we seal full box to make sure carton is strong enough and waterproof. Each box is labeld with shipping marks at customer's request. Shipping:Postage, Express, By Air, By Sea, FBA etc, wihitop offers the most reasonable and prompt delivery method.
Payment:Payment methods: T/T, Credit Card, Western Union, etc. Credit Card payment,
FAQ
1. I'd like to visit your latest products and quotations, how can I get them?
Welcome to contact us directly by online messager, Trademanager or Whatsapp for latest catalogues. Send us inquiry or direct email is welcome too.
2. I would prefer mix different designs in one order, can I do and how should we process?
Yes, we welcome mix different designs or various colors in one order. We can discuss through email and we usually send P/I with all details for approval.
3. How long does it take for you to process my order?
For items in stock, we usually effect shipment in 3 days. For items out of stock, or new production required, we usually need 2 weeks to process.
4. Who would pay for Customs Duties?
Buyer is responsible for any applicable import duties and local fee. Please verify with your Customs or Express agents before confirm your purchase.
5. What is your product warrenty?
You can enjoy 1 year warrenty for almost of our products.
6. What is your return policy?
We will do our best on controling quality and logistics. However, complication tends to happen on international orders. If you do not receive your order on time or if you are not satisfied with our product quality or quantity problems, please contact us as soon as you receive the parcel. The request of returns must be made within 5 days upon order receipts.
We understand the frustrations you might have, please contact us before open dispute or leaving any negative feedbacks. We appreciate your time and patience on helping us solve any problems.
0 likes
China [CN] 
Click enlarge Image